PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g86400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NAC
Protein Properties Length: 383aa    MW: 43117.8 Da    PI: 5.5426
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g86400genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.58e-51121391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 l+pGfrFhPtdeelv++yL++kv gk++++ ++++e+d+yk+eP +L +  ++k+++ ewyfFs+ dkky +g+r nrat +gyWkatgkd+ v + k+
  CA00g86400  12 LAPGFRFHPTDEELVMYYLRRKVCGKPFRF-QAVAEIDVYKFEPGELAEhsSLKTRDLEWYFFSPVDKKYCNGSRLNRATGQGYWKATGKDRYVRH-KS 108
                 579*************************99.88**************84246777888*************************************9.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +++g+kktLvf++grap+g++t+Wvmheyrl
  CA00g86400 109 QAIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 139
                 9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-6010162IPR003441NAC domain
PROSITE profilePS5100556.18212162IPR003441NAC domain
PfamPF023654.2E-2814139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MVATPTPAPT SLAPGFRFHP TDEELVMYYL RRKVCGKPFR FQAVAEIDVY KFEPGELAEH  60
SSLKTRDLEW YFFSPVDKKY CNGSRLNRAT GQGYWKATGK DRYVRHKSQA IGMKKTLVFH  120
SGRAPDGKRT NWVMHEYRLA DEELEKAGVV QDCFVLCRIF QKSALGPPTG DRYAPFIEEE  180
WDDDSAVLPG GDMVDDVVNG VEARVESNDL DQDALPKTAR HSENLTEPRG LPFVCKRERS  240
EEPELLSLSQ SKRSQHDVPS SSRANGSEDS TFTSQDPVNM MTTKDCPLAL LGFPLLEPFE  300
PKESQPCNPL TFDSSNLDKS VPPGYLKFIS NLENGILNVS MERETLKIEV MRAQAMINVL  360
QSRIDLLTKE NEDMRRLVRG GG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-521116416167NO APICAL MERISTEM PROTEIN
1ut4_B4e-521116416167NO APICAL MERISTEM PROTEIN
1ut7_A4e-521116416167NO APICAL MERISTEM PROTEIN
1ut7_B4e-521116416167NO APICAL MERISTEM PROTEIN
3swm_A5e-521116419170NAC domain-containing protein 19
3swm_B5e-521116419170NAC domain-containing protein 19
3swm_C5e-521116419170NAC domain-containing protein 19
3swm_D5e-521116419170NAC domain-containing protein 19
3swp_A5e-521116419170NAC domain-containing protein 19
3swp_B5e-521116419170NAC domain-containing protein 19
3swp_C5e-521116419170NAC domain-containing protein 19
3swp_D5e-521116419170NAC domain-containing protein 19
4dul_A4e-521116416167NAC domain-containing protein 19
4dul_B4e-521116416167NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016573813.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLA0A0V0I4D10.0A0A0V0I4D1_SOLCH; Putative NAC domain-containing protein 78-like
STRINGSolyc05g055480.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.12e-89NAC domain containing protein 52